![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulfide-linked, and a calcium-binding loop |
![]() | Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) ![]() |
![]() | Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins) automatically mapped to Pfam PF00068 |
![]() | Protein Phospholipase A2 [48637] (5 species) |
![]() | Species Human (Homo sapiens), synovial fluid [TaxId:9606] [48638] (16 PDB entries) |
![]() | Domain d1poea_: 1poe A: [19571] complexed with ca, gel |
PDB Entry: 1poe (more details), 2.1 Å
SCOPe Domain Sequences for d1poea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1poea_ a.133.1.2 (A:) Phospholipase A2 {Human (Homo sapiens), synovial fluid [TaxId: 9606]} nlvnfhrmiklttgkeaalsygfygchcgvggrgspkdatdrccvthdccykrlekrgcg tkflsykfsnsgsritcakqdscrsqlcecdkaaatcfarnkttynkkyqyysnkhcrgs tprc
Timeline for d1poea_: