SCOPe 2.08: Domain d3r37b_: 3r37 B:

Lineage for d3r37b_ (3r37 B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families)

5. Family d.38.1.5: PaaI/YdiI-like [89902] (15 proteins)

6. Protein automated matches [190102] (7 species)
   not a true protein

7. Species Arthrobacter sp. [TaxId:1667] [194804] (11 PDB entries)

8. Domain d3r37b_: 3r37 B: [195706]
   automated match to d1q4ta_
   complexed with 4co; mutant

Details for d3r37b_

PDB Entry: 3r37, 1.8 Å

PDB Description: crystal structure of arthrobacter sp. strain su 4-hydroxybenzoyl coa thioesterase mutant e73q complexed with 4-hydroxyphenacyl coa

PDB Compounds: (B:) 4-hydroxybenzoyl-CoA Thioesterase

SCOPe Domain Sequences for d3r37b_:

Sequence; same for both SEQRES and ATOM records:

>d3r37b_ d.38.1.5 (B:) automated matches {Arthrobacter sp. [TaxId: 1667]}
ggnlpdvashypvayeqtldgtvgfvidemtperatasvevtdtlrqrwglvhggaycal
aqmlateatvavvhekgmmavgqsnhtsffrpvkeghvraeavrihagsttwfwdvslrd
dagrlcavssmsiavrprrd

Timeline for d3r37b_:

• d3r37b_ first appeared in SCOPe 2.02
  
• d3r37b_ appears in SCOPe 2.07