Lineage for d3sz6a_ (3sz6 A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1112528Superfamily b.1.28: NEAT domain-like [158911] (2 families) (S)
  5. 1112560Family b.1.28.0: automated matches [195425] (1 protein)
    not a true family
  6. 1112561Protein automated matches [195426] (1 species)
    not a true protein
  7. 1112562Species Bacillus anthracis [TaxId:1392] [195437] (4 PDB entries)
  8. 1112564Domain d3sz6a_: 3sz6 A: [195701]
    automated match to d2o1aa1
    complexed with cl, gol

Details for d3sz6a_

PDB Entry: 3sz6 (more details), 1.8 Å

PDB Description: IsdX1, an anthrax hemophore
PDB Compounds: (A:) conserved domain protein

SCOPe Domain Sequences for d3sz6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sz6a_ b.1.28.0 (A:) automated matches {Bacillus anthracis [TaxId: 1392]}
tkladgkyniaftvwkgdkdessrmnryfespatltvkngkqyvsfkvkdstsiksfqve
kdgqfvettvlsenkkdntrvvefevadlskklngkvkinipiinynasydirfvf

SCOPe Domain Coordinates for d3sz6a_:

Click to download the PDB-style file with coordinates for d3sz6a_.
(The format of our PDB-style files is described here.)

Timeline for d3sz6a_: