SCOPe 2.08: Domain d3sz6b_: 3sz6 B:

Lineage for d3sz6b_ (3sz6 B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.28: NEAT domain-like [158911] (2 families)

5. Family b.1.28.0: automated matches [195425] (1 protein)
   not a true family

6. Protein automated matches [195426] (7 species)
   not a true protein

7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [195437] (5 PDB entries)

8. Domain d3sz6b_: 3sz6 B: [195700]
   automated match to d2o1aa1
   complexed with cl, gol

Details for d3sz6b_

PDB Entry: 3sz6, 1.8 Å

PDB Description: IsdX1, an anthrax hemophore

PDB Compounds: (B:) conserved domain protein

SCOPe Domain Sequences for d3sz6b_:

Sequence; same for both SEQRES and ATOM records:

>d3sz6b_ b.1.28.0 (B:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
tkladgkyniaftvwkgdkdessrmnryfespatltvkngkqyvsfkvkdstsiksfqve
kdgqfvettvlsenkkdntrvvefevadlskklngkvkinipiinynasydirfvf

Timeline for d3sz6b_:

• d3sz6b_ first appeared in SCOPe 2.02
  
• d3sz6b_ appears in SCOPe 2.07