SCOPe 2.07: Domain d3ttlb_: 3ttl B:

Lineage for d3ttlb_ (3ttl B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (158 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [195692] (5 PDB entries)

8. Domain d3ttlb_: 3ttl B: [195693]
   automated match to d1a99a_

Details for d3ttlb_

PDB Entry: 3ttl, 2.3 Å

PDB Description: Crystal structure of apo-SpuE

PDB Compounds: (B:) Polyamine transport protein

SCOPe Domain Sequences for d3ttlb_:

Sequence; same for both SEQRES and ATOM records:

>d3ttlb_ c.94.1.0 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
slhiynwtdyiapttlkdftkesgidvsydvfdsnetlegklvsghsgydivvpsnnflg
kqiqagafqkldksklpnwknldpallkqlevsdpgnqyavpylwgtngigynvakvkev
lgdqpidswailfepenmkklakcgvafmdsgdemlpaalnylgldpnthdpkdykkaee
vltkvrpyvsyfhsskyisdlangnicvafgysgdvfqaaaraeeagkgidiqyvipkeg
anlwfdlmaipadakaadnayafidyllrpeviakvsdyvgyanaipgarplmdksvsds
eevyppqavldklyvsavlpakvlrlqtrtwtrik

Timeline for d3ttlb_:

• d3ttlb_ first appeared in SCOPe 2.02
  
• d3ttlb_ appears in SCOPe 2.06
  
• d3ttlb_ appears in the current release, SCOPe 2.08