Lineage for d3ubca_ (3ubc A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1979527Family a.1.1.0: automated matches [191420] (1 protein)
    not a true family
  6. 1979528Protein automated matches [190590] (21 species)
    not a true protein
  7. 1979605Species Methylacidiphilum infernorum [TaxId:481448] [195689] (5 PDB entries)
  8. 1979606Domain d3ubca_: 3ubc A: [195690]
    automated match to d1oj6b_
    complexed with hem, oxy

Details for d3ubca_

PDB Entry: 3ubc (more details), 1.65 Å

PDB Description: Oxygen-bound hell's gate globin I by LB nanotemplate method
PDB Compounds: (A:) Hemoglobin-like flavoprotein

SCOPe Domain Sequences for d3ubca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ubca_ a.1.1.0 (A:) automated matches {Methylacidiphilum infernorum [TaxId: 481448]}
idqkekelikeswkriepnkneigllfyanlfkeeptvsvlfqnpissqsrklmqvlgil
vqgidnlegliptlqdlgrrhkqygvvdshyplvgdcllksiqeylgqgfteeakaawtk
vygiaaqvmta

SCOPe Domain Coordinates for d3ubca_:

Click to download the PDB-style file with coordinates for d3ubca_.
(The format of our PDB-style files is described here.)

Timeline for d3ubca_: