SCOPe 2.08: Domain d3v96b_: 3v96 B:

Lineage for d3v96b_ (3v96 B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)

6. Protein automated matches [190182] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186920] (33 PDB entries)

8. Domain d3v96b_: 3v96 B: [195680]
   Other proteins in same PDB: d3v96a_
   automated match to d1q3ab_
   complexed with ca, po4, zn

Details for d3v96b_

PDB Entry: 3v96, 1.9 Å

PDB Description: Complex of matrix metalloproteinase-10 catalytic domain (MMP-10cd) with tissue inhibitor of metalloproteinases-1 (TIMP-1)

PDB Compounds: (B:) Stromelysin-2

SCOPe Domain Sequences for d3v96b_:

Sequence; same for both SEQRES and ATOM records:

>d3v96b_ d.92.1.11 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mpkwrkthltyrivnytpdlprdavdsaiekalkvweevtpltfsrlyegeadimisfav
kehgdfysfdgpghslahayppgpglygdihfdddekwtedasgtnlflvaahelghslg
lfhsantealmyplynsftelaqfrlsqddvngiqslyg

Timeline for d3v96b_:

• d3v96b_ first appeared in SCOPe 2.02
  
• d3v96b_ appears in SCOPe 2.07