Lineage for d2ydab_ (2yda B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2443024Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2443025Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 2443602Protein automated matches [190095] (28 species)
    not a true protein
  7. 2443885Species Sulfolobus solfataricus [TaxId:2287] [195677] (7 PDB entries)
  8. 2443887Domain d2ydab_: 2yda B: [195678]
    automated match to d1w3ia_
    complexed with epe, gol, ipa

Details for d2ydab_

PDB Entry: 2yda (more details), 1.91 Å

PDB Description: Sulfolobus sulfataricus 2-keto-3-deoxygluconate aldolase Y103F,Y130F, A198F variant
PDB Compounds: (B:) 2-keto-3-deoxy gluconate aldolase

SCOPe Domain Sequences for d2ydab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ydab_ c.1.10.1 (B:) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
peiitpiitpftkdnridkeklkihaenlirkgidklfvngttglgpslspeeklenlka
vydvtnkiifqvgglnlddairlaklskdfdivgiasyapyfyprmsekhlvkyfktlce
vsphpvylfnyptatgkdidakvakeigcftgvkdtieniihtldykrlnpnmlvysgsd
mliatvastgldgnvafgsnylpevtvtikklamerkidealklqflhdevieasrifgs
lssnyvltkyfqgydlgyprppifplddeeerqlikkvegiraklvelkilke

SCOPe Domain Coordinates for d2ydab_:

Click to download the PDB-style file with coordinates for d2ydab_.
(The format of our PDB-style files is described here.)

Timeline for d2ydab_: