SCOPe 2.02: Domain d2ydab_: 2yda B:

Lineage for d2ydab_ (2yda B:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.1: Class I aldolase [51570] (13 proteins)
   the catalytic lysine forms schiff-base intermediate with substrate
   possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels

6. Protein automated matches [190095] (15 species)
   not a true protein

7. Species Sulfolobus solfataricus [TaxId:2287] [195677] (1 PDB entry)

8. Domain d2ydab_: 2yda B: [195678]
   automated match to d1w3ia_
   complexed with epe, gol, ipa

Details for d2ydab_

PDB Entry: 2yda, 1.91 Å

PDB Description: Sulfolobus sulfataricus 2-keto-3-deoxygluconate aldolase Y103F,Y130F, A198F variant

PDB Compounds: (B:) 2-keto-3-deoxy gluconate aldolase

SCOPe Domain Sequences for d2ydab_:

Sequence; same for both SEQRES and ATOM records:

>d2ydab_ c.1.10.1 (B:) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
peiitpiitpftkdnridkeklkihaenlirkgidklfvngttglgpslspeeklenlka
vydvtnkiifqvgglnlddairlaklskdfdivgiasyapyfyprmsekhlvkyfktlce
vsphpvylfnyptatgkdidakvakeigcftgvkdtieniihtldykrlnpnmlvysgsd
mliatvastgldgnvafgsnylpevtvtikklamerkidealklqflhdevieasrifgs
lssnyvltkyfqgydlgyprppifplddeeerqlikkvegiraklvelkilke

Timeline for d2ydab_:

• d2ydab_ is new in SCOPe 2.02-stable
  
• d2ydab_ appears in SCOPe 2.03
  
• d2ydab_ appears in the current release, SCOPe 2.08