Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.61: LigT-like [55143] (1 superfamily) duplication of beta-alpha-beta-alpha-beta motif: antiparallel beta sheet forms barrel (n=6, S=8) similar to the barrel of prokaryotic DNA topoisomerases I and III |
Superfamily d.61.1: LigT-like [55144] (5 families) |
Family d.61.1.3: 2',3'-cyclic nucleotide 3'-phosphodiesterase, catalytic domain [103043] (2 proteins) automatically mapped to Pfam PF05881 |
Protein automated matches [190813] (2 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [189888] (31 PDB entries) |
Domain d2ydca_: 2ydc A: [195676] automated match to d2y3xb_ complexed with gdp |
PDB Entry: 2ydc (more details), 2.05 Å
SCOPe Domain Sequences for d2ydca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ydca_ d.61.1.3 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} kdflplyfgwfltkkssetlrkagqvfleelgnhkafkkelrhfisgdepkeklelvsyf gkrppgvlhcttkfcdygkaagaeeyaqqevvkrsygkafklsisalfvtpktagaqvvl tdqelqlwpsdldkpsaseglppgsrahvtlgcaadvqpvqtgldlldilqqvkggsqge avgelprgklyslgkgrwmlsltkkmevkaiftgyyg
Timeline for d2ydca_: