SCOPe 2.02: Domain d4e7na_: 4e7n A:

Lineage for d4e7na_ (4e7n A:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)

6. Protein automated matches [190044] (13 species)
   not a true protein

7. Species Agkistrodon halys [TaxId:8714] [195671] (1 PDB entry)

8. Domain d4e7na_: 4e7n A: [195672]
   automated match to d2aiqa_
   complexed with gol

Details for d4e7na_

PDB Entry: 4e7n, 1.75 Å

PDB Description: crystal structure of ahv_tl-i, a glycosylated snake-venom thrombin- like enzyme from agkistrodon halys

PDB Compounds: (A:) Snake-venom Thrombin-like Enzyme

SCOPe Domain Sequences for d4e7na_:

Sequence; same for both SEQRES and ATOM records:

>d4e7na_ b.47.1.2 (A:) automated matches {Agkistrodon halys [TaxId: 8714]}
iiggdecninehrflvalytsrsrtlfcggtlinqewvltaahcdrknfriklgmhskkv
pnedeqtrvpkekffclssknytlwdkdimlirldspvknskhiapfslpssppsvgsvc
rimgwgrisptegtypdvphcvninlleyemcrapypefelpatsrtlcagileggkdtc
kgdsggplicngqfqgiaswgddpcaqphkpaaytkvfdhldwieniiagntdascpp

Timeline for d4e7na_:

• d4e7na_ is new in SCOPe 2.02-stable
  
• d4e7na_ appears in SCOPe 2.03
  
• d4e7na_ appears in the current release, SCOPe 2.08