![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
![]() | Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
![]() | Protein automated matches [190044] (14 species) not a true protein |
![]() | Species Halys viper (Agkistrodon halys) [TaxId:8714] [195671] (1 PDB entry) |
![]() | Domain d4e7na_: 4e7n A: [195672] automated match to d2aiqa_ complexed with gol |
PDB Entry: 4e7n (more details), 1.75 Å
SCOPe Domain Sequences for d4e7na_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4e7na_ b.47.1.2 (A:) automated matches {Halys viper (Agkistrodon halys) [TaxId: 8714]} iiggdecninehrflvalytsrsrtlfcggtlinqewvltaahcdrknfriklgmhskkv pnedeqtrvpkekffclssknytlwdkdimlirldspvknskhiapfslpssppsvgsvc rimgwgrisptegtypdvphcvninlleyemcrapypefelpatsrtlcagileggkdtc kgdsggplicngqfqgiaswgddpcaqphkpaaytkvfdhldwieniiagntdascpp
Timeline for d4e7na_: