Lineage for d4e7na_ (4e7n A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2794859Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2796823Protein automated matches [190044] (14 species)
    not a true protein
  7. 2796871Species Halys viper (Agkistrodon halys) [TaxId:8714] [195671] (1 PDB entry)
  8. 2796872Domain d4e7na_: 4e7n A: [195672]
    automated match to d2aiqa_
    complexed with gol

Details for d4e7na_

PDB Entry: 4e7n (more details), 1.75 Å

PDB Description: crystal structure of ahv_tl-i, a glycosylated snake-venom thrombin- like enzyme from agkistrodon halys
PDB Compounds: (A:) Snake-venom Thrombin-like Enzyme

SCOPe Domain Sequences for d4e7na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4e7na_ b.47.1.2 (A:) automated matches {Halys viper (Agkistrodon halys) [TaxId: 8714]}
iiggdecninehrflvalytsrsrtlfcggtlinqewvltaahcdrknfriklgmhskkv
pnedeqtrvpkekffclssknytlwdkdimlirldspvknskhiapfslpssppsvgsvc
rimgwgrisptegtypdvphcvninlleyemcrapypefelpatsrtlcagileggkdtc
kgdsggplicngqfqgiaswgddpcaqphkpaaytkvfdhldwieniiagntdascpp

SCOPe Domain Coordinates for d4e7na_:

Click to download the PDB-style file with coordinates for d4e7na_.
(The format of our PDB-style files is described here.)

Timeline for d4e7na_: