Lineage for d4e77a_ (4e77 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132229Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2132230Protein automated matches [190151] (121 species)
    not a true protein
  7. 2133056Species Yersinia pestis [TaxId:386656] [195669] (1 PDB entry)
  8. 2133057Domain d4e77a_: 4e77 A: [195670]
    automated match to d3bs8a_
    complexed with na, no3

Details for d4e77a_

PDB Entry: 4e77 (more details), 2 Å

PDB Description: 2.0A Crystal Structure of a Glutamate-1-Semialdehyde Aminotransferase from Yersinia pestis CO92
PDB Compounds: (A:) Glutamate-1-semialdehyde 2,1-aminomutase

SCOPe Domain Sequences for d4e77a_:

Sequence, based on SEQRES records: (download)

>d4e77a_ c.67.1.0 (A:) automated matches {Yersinia pestis [TaxId: 386656]}
msksenlyaqaqqlipggvnspvraftgvggiplfieradgaylfdvdgkayidyvgswg
pmilghnhpairqavieaverglsfgaptemevkmaqlvtdlvptmdmvrmvnsgteatm
sairlargytgrdkiikfegcyhghadcllvkagsgaltlgqpnspgvptdfakhtltct
yndlasvrqafeqypqevaciivepvagnmncipplpeflpglralcdefgalliidevm
tgfrvalagaqdyyhvipdltclgkiigggmpvgafggrrevmnalaptgpvyqagtlsg
npiamaagfaclteisqvgvyetlteltdslatglrhaakeeniplvvnhvggmfglfft
nadtvtcyqdvmncdverfkrffhlmleegvylapsafeagfmslahsnediqktvnaar
rcfakl

Sequence, based on observed residues (ATOM records): (download)

>d4e77a_ c.67.1.0 (A:) automated matches {Yersinia pestis [TaxId: 386656]}
msksenlyaqaqqlipggvnspvraftgvggiplfieradgaylfdvdgkayidyvgswg
pmilghnhpairqavieaverglsfgaptemevkmaqlvtdlvptmdmvrmvnsgteatm
sairlargytgrdkiikfegcyhgpnspgvptdfakhtltctyndlasvrqafeqypqev
aciivepvagnmncipplpeflpglralcdefgalliidevmtgfrvalagaqdyyhvip
dltclgkiigggmpvgafggrrevmnalaptgpvyqtlsgnpiamaagfaclteisqvgv
yetlteltdslatglrhaakeeniplvvnhvggmfglfftnadtvtcyqdvmncdverfk
rffhlmleegvylapsafeagfmslahsnediqktvnaarrcfakl

SCOPe Domain Coordinates for d4e77a_:

Click to download the PDB-style file with coordinates for d4e77a_.
(The format of our PDB-style files is described here.)

Timeline for d4e77a_: