Lineage for d3t0qa_ (3t0q A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2111568Family c.37.1.9: Motor proteins [52641] (5 protein domains)
  6. 2111709Protein automated matches [190129] (6 species)
    not a true protein
  7. 2111710Species Ashbya gossypii [TaxId:284811] [195661] (1 PDB entry)
  8. 2111711Domain d3t0qa_: 3t0q A: [195662]
    automated match to d1f9va_
    complexed with adp, edo, mg

Details for d3t0qa_

PDB Entry: 3t0q (more details), 2.35 Å

PDB Description: motor domain structure of the kar3-like kinesin from ashbya gossypii
PDB Compounds: (A:) AGR253Wp

SCOPe Domain Sequences for d3t0qa_:

Sequence, based on SEQRES records: (download)

>d3t0qa_ c.37.1.9 (A:) automated matches {Ashbya gossypii [TaxId: 284811]}
gnirvycrvrppllnepqdmshiliekfneakgaqsltinrnegrilsynfqfdmifeps
htnkeifeeirqlvqssldgynvcifaygqtgsgktytmlnagdgmipmtlshifkwtan
lkergwnyemeceyieiynetildllrdfkshdnideildsqkhdirhdhekqgtyitnv
trmkmtstsqvdtilkkaskmrstaatrsnerssrshsvfmvhingrnlhtgetsqgkln
lvdlagserinssavtgerlretqninkslsclgdviyalntpdagkryipfrnskltyl
lqyslvgdsktlmfvnippdpnhisetlnslrfaskvns

Sequence, based on observed residues (ATOM records): (download)

>d3t0qa_ c.37.1.9 (A:) automated matches {Ashbya gossypii [TaxId: 284811]}
gnirvycrvrppllnepqdmshiliekfnegaqsltinrneilsynfqfdmifepshtnk
eifeeirqlvqssldgynvcifaygqtgsgktytmlnagdgmipmtlshifkwtanlker
gwnyemeceyieiynetildllrkhdirhdhekqgtyitnvtrmkmtstsqvdtilkkae
rssrshsvfmvhingrnlhtgetsqgklnlvdlagserintgerlretqninkslsclgd
viyalntpdagkryipfrnskltyllqyslvgdsktlmfvnippdpnhisetlnslrfas
kvns

SCOPe Domain Coordinates for d3t0qa_:

Click to download the PDB-style file with coordinates for d3t0qa_.
(The format of our PDB-style files is described here.)

Timeline for d3t0qa_: