SCOPe 2.08: Domain d3tl1a_: 3tl1 A:

Lineage for d3tl1a_ (3tl1 A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.0: automated matches [191339] (1 protein)
   not a true family

6. Protein automated matches [190218] (21 species)
   not a true protein

7. Species Streptomyces coelicolor [TaxId:1902] [195657] (2 PDB entries)

8. Domain d3tl1a_: 3tl1 A: [195659]
   automated match to d2reza_
   complexed with gol, jro

Details for d3tl1a_

PDB Entry: 3tl1, 1.8 Å

PDB Description: Crystal structure of the Streptomyces coelicolor WhiE ORFVI polyketide aromatase/cyclase

PDB Compounds: (A:) Polyketide cyclase

SCOPe Domain Sequences for d3tl1a_:

Sequence; same for both SEQRES and ATOM records:

>d3tl1a_ d.129.3.0 (A:) automated matches {Streptomyces coelicolor [TaxId: 1902]}
maghtdneitiaapmelvwnmtndiekwpglfseyasvevlgrdddkvtfrltmhpdadg
kvwswvservadpvtrtvraqrvetgpfqymnivweyaetaegtvmrwtqdfamkpdapv
ddawmtdninrnsrtqmalirdrieqaagerrtasvla

Timeline for d3tl1a_:

• d3tl1a_ first appeared in SCOPe 2.02
  
• d3tl1a_ appears in SCOPe 2.07