Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.3: Bet v1-like [55961] (11 families) contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
Family d.129.3.0: automated matches [191339] (1 protein) not a true family |
Protein automated matches [190218] (13 species) not a true protein |
Species Streptomyces coelicolor [TaxId:1902] [195657] (2 PDB entries) |
Domain d3tl1b_: 3tl1 B: [195658] automated match to d2reza_ complexed with gol, jro |
PDB Entry: 3tl1 (more details), 1.8 Å
SCOPe Domain Sequences for d3tl1b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tl1b_ d.129.3.0 (B:) automated matches {Streptomyces coelicolor [TaxId: 1902]} maghtdneitiaapmelvwnmtndiekwpglfseyasvevlgrdddkvtfrltmhpdadg kvwswvservadpvtrtvraqrvetgpfqymnivweyaetaegtvmrwtqdfamkpdapv ddawmtdninrnsrtqmalirdrieqaagerrtasvla
Timeline for d3tl1b_: