Lineage for d3u1ub_ (3u1u B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2045654Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2047797Superfamily b.34.21: Plus3-like [159042] (1 family) (S)
    automatically mapped to Pfam PF03126
  5. 2047798Family b.34.21.1: Plus3 [159043] (2 protein domains)
    Pfam PF03126
  6. 2047799Protein RNA polymerase-associated protein RTF1 homolog [159044] (1 species)
  7. 2047800Species Human (Homo sapiens) [TaxId:9606] [159045] (3 PDB entries)
    Uniprot Q92541 307-442! Uniprot Q92541 313-444
  8. 2047802Domain d3u1ub_: 3u1u B: [195654]
    automated match to d2db9a1
    complexed with gol, so4, unx

Details for d3u1ub_

PDB Entry: 3u1u (more details), 1.8 Å

PDB Description: crystal structure of rna polymerase-associated protein rtf1 homolog plus-3 domain
PDB Compounds: (B:) RNA polymerase-associated protein RTF1 homolog

SCOPe Domain Sequences for d3u1ub_:

Sequence, based on SEQRES records: (download)

>d3u1ub_ b.34.21.1 (B:) RNA polymerase-associated protein RTF1 homolog {Human (Homo sapiens) [TaxId: 9606]}
sqpvslpeelnrvrlsrhklerwchmpffaktvtgcfvrigignhnskpvyrvaeitgvv
etakvyqlggtrtnkglqlrhgndqrvfrlefvsnqeftesefmkwkeamfsagmqlptl
deinkkelsikea

Sequence, based on observed residues (ATOM records): (download)

>d3u1ub_ b.34.21.1 (B:) RNA polymerase-associated protein RTF1 homolog {Human (Homo sapiens) [TaxId: 9606]}
sqpvslpeelnrvrlsrhklerwchmpffaktvtgcfvrigignpvyrvaeitgvvetak
vyqlggtrtnkglqlrhgndqrvfrlefvsnqeftesefmkwkeamfsagmqlptldein
kkelsikea

SCOPe Domain Coordinates for d3u1ub_:

Click to download the PDB-style file with coordinates for d3u1ub_.
(The format of our PDB-style files is described here.)

Timeline for d3u1ub_: