Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins) members organized in the groups and subfamiles specified by the comments |
Protein automated matches [190091] (10 species) not a true protein |
Species Homo sapiens [TaxId:9606] [192729] (55 PDB entries) |
Domain d2ydka_: 2ydk A: [195651] automated match to d2x8da_ complexed with gol, so4, ydk |
PDB Entry: 2ydk (more details), 1.9 Å
SCOPe Domain Sequences for d2ydka_:
Sequence, based on SEQRES records: (download)
>d2ydka_ d.144.1.7 (A:) automated matches {Homo sapiens [TaxId: 9606]} vpfvedwdlvqtlgegaygevqlavnrvteeavavkivdmkravdcpenikkeicinkml nhenvvkfyghrregniqylfleycsggelfdriepdigmpepdaqrffhqlmagvvylh gigithrdikpenlllderdnlkisdfglatvfrynnrerllnkmcgtlpyvapellkrr efhaepvdvwscgivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsaplall hkilvenpsaritipdikkdrwynkplk
>d2ydka_ d.144.1.7 (A:) automated matches {Homo sapiens [TaxId: 9606]} vpfvedwdlvqtlgegaygevqlavnrvteeavavkivdmkrenikkeicinkmlnhenv vkfyghrregniqylfleycsggelfdriepdigmpepdaqrffhqlmagvvylhgigit hrdikpenlllderdnlkisdfglatvfrynnrerllnkmcgtlpyvapellkrrefhae pvdvwscgivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsaplallhkilv enpsaritipdikkdrwynkplk
Timeline for d2ydka_: