Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.82: ALDH-like [53719] (1 superfamily) consists of two similar domains with 3 layers (a/b/a) each; duplication core: parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.82.1: ALDH-like [53720] (3 families) binds NAD differently from other NAD(P)-dependent oxidoreductases |
Family c.82.1.0: automated matches [191448] (1 protein) not a true family |
Protein automated matches [190683] (7 species) not a true protein |
Species Spinacia oleracea [TaxId:3562] [195640] (1 PDB entry) |
Domain d4a0md_: 4a0m D: [195644] automated match to d3iwja_ complexed with gol, k, nad |
PDB Entry: 4a0m (more details), 2.3 Å
SCOPe Domain Sequences for d4a0md_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4a0md_ c.82.1.0 (D:) automated matches {Spinacia oleracea [TaxId: 3562]} fpiparqlfidgewrepikknripvinpsteeiigdipaataedvevavvaarrafrrnn wsatsgahratylraiaakitekkdhfvkletidsgkpfdeavldiddvascfeyfagqa ealdgkqkapvtlpmerfkshvlrqplgvvglispwnypllmatwkiapalaagctavlk pselasvtclefgevcnevglppgvlniltglgpdagaplvshpdvdkiaftgssatgsk vmasaaqlvkpvtlelggkspivvfedvdidkvvewtifgcfwtngqicsatsrllvhes iaaefvdklvkwtknikisdpfeegcrlgpviskgqydkimkfistaksegatilyggsr pehlkkgyyieptivtdistsmqiwkeevfgpvlcvktfssedeaialandteyglaaav fsndlerceritkalevgavwvncsqpcfvqapwggikrsgfgrelgewgiqnylnikqv tqdisdepwgwyks
Timeline for d4a0md_: