SCOPe 2.05: Domain d3axkt_: 3axk T:

Lineage for d3axkt_ (3axk T:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
   alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta

4. Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family)

5. Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins)

6. Protein automated matches [190066] (5 species)
   not a true protein

7. Species Oryza sativa [TaxId:39947] [195635] (2 PDB entries)

8. Domain d3axkt_: 3axk T: [195638]
   Other proteins in same PDB: d3axka1, d3axka2, d3axkb1, d3axkb2
   automated match to d1wdds_
   complexed with gol, mg, ndp

Details for d3axkt_

PDB Entry: 3axk, 1.9 Å

PDB Description: Structure of rice Rubisco in complex with NADP(H)

PDB Compounds: (T:) Ribulose bisphosphate carboxylase small chain, chloroplastic

SCOPe Domain Sequences for d3axkt_:

Sequence; same for both SEQRES and ATOM records:

>d3axkt_ d.73.1.1 (T:) automated matches {Oryza sativa [TaxId: 39947]}
xmqvwpiegikkfetlsylppltvedllkqieyllrskwvpclefskvgfvyrenhrspg
yydgrywtmwklpmfgctdatqvlkeleeakkaypdafvriigfdnvrqvqcisfiaykp

Timeline for d3axkt_:

• d3axkt_ first appeared in SCOPe 2.02
  
• d3axkt_ appears in SCOPe 2.04
  
• d3axkt_ appears in SCOPe 2.06
  
• d3axkt_ appears in the current release, SCOPe 2.08