SCOPe 2.03: Domain d4ds0a_: 4ds0 A:

Lineage for d4ds0a_ (4ds0 A:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (23 species)
   not a true protein

7. Species Rotavirus sp. [TaxId:10970] [195633] (3 PDB entries)

8. Domain d4ds0a_: 4ds0 A: [195634]
   automated match to d2p3ka_

Details for d4ds0a_

PDB Entry: 4ds0, 1.56 Å

PDB Description: cell attachment protein vp8* of a human rotavirus specifically interacts with a-type histo-blood group antigen

PDB Compounds: (A:) Outer capsid protein VP4

SCOPe Domain Sequences for d4ds0a_:

Sequence; same for both SEQRES and ATOM records:

>d4ds0a_ b.29.1.0 (A:) automated matches {Rotavirus sp. [TaxId: 10970]}
gstldgpyqpttfnlpidywmliaptqigrvaegtnttdrwfacvlvepnvqntqreyvl
dgqtvqlqvsnnsstlwkfilfiklekngaysqystlstsnklcawmkregrvywyagtt
pnasesyyltinndnsnvscdaefyliprsqtelctqyinngl

Timeline for d4ds0a_:

• d4ds0a_ first appeared in SCOPe 2.02
  
• d4ds0a_ appears in SCOPe 2.04
  
• d4ds0a_ appears in the current release, SCOPe 2.08, called d4ds0a1