![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
![]() | Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
![]() | Protein automated matches [190437] (70 species) not a true protein |
![]() | Species Rotavirus sp. [TaxId:10970] [195633] (3 PDB entries) |
![]() | Domain d4ds0a1: 4ds0 A:64-224 [195634] Other proteins in same PDB: d4ds0a2 automated match to d2p3ka_ |
PDB Entry: 4ds0 (more details), 1.56 Å
SCOPe Domain Sequences for d4ds0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ds0a1 b.29.1.0 (A:64-224) automated matches {Rotavirus sp. [TaxId: 10970]} tldgpyqpttfnlpidywmliaptqigrvaegtnttdrwfacvlvepnvqntqreyvldg qtvqlqvsnnsstlwkfilfiklekngaysqystlstsnklcawmkregrvywyagttpn asesyyltinndnsnvscdaefyliprsqtelctqyinngl
Timeline for d4ds0a1: