Lineage for d4dssb_ (4dss B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2131616Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2131617Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2133854Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2133855Protein automated matches [190056] (165 species)
    not a true protein
  7. 2134015Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [195631] (4 PDB entries)
  8. 2134017Domain d4dssb_: 4dss B: [195632]
    automated match to d3pina_

Details for d4dssb_

PDB Entry: 4dss (more details), 2.1 Å

PDB Description: crystal structure of peroxiredoxin ahp1 from saccharomyces cerevisiae in complex with thioredoxin trx2
PDB Compounds: (B:) Thioredoxin-2

SCOPe Domain Sequences for d4dssb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dssb_ c.47.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
mvtqlksaseydsalasgdklvvvdffatwcgpskmiapmiekfaeqysdaafykldvde
vsdvaqkaevssmptlifykggkevtrvvganpaaikqaiasnv

SCOPe Domain Coordinates for d4dssb_:

Click to download the PDB-style file with coordinates for d4dssb_.
(The format of our PDB-style files is described here.)

Timeline for d4dssb_: