SCOPe 2.06: Domain d1fe5a_: 1fe5 A:

Lineage for d1fe5a_ (1fe5 A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
   automatically mapped to Pfam PF00068

6. Protein Snake phospholipase A2 [48624] (38 species)

7. Species Indian krait (Bungarus caeruleus), different isoforms [TaxId:132961] [48636] (7 PDB entries)
   Uniprot Q6SLM1 # fragment; Uniprot Q9DF52 28-145 # ! 74% sequence identity

8. Domain d1fe5a_: 1fe5 A: [19563]
   complexed with ca

Details for d1fe5a_

PDB Entry: 1fe5, 2.45 Å

PDB Description: sequence and crystal structure of a basic phospholipase a2 from common krait (bungarus caeruleus) at 2.4 resolution: identification and characterization of its pharmacological sites.

PDB Compounds: (A:) phospholipase a2

SCOPe Domain Sequences for d1fe5a_:

Sequence; same for both SEQRES and ATOM records:

>d1fe5a_ a.133.1.2 (A:) Snake phospholipase A2 {Indian krait (Bungarus caeruleus), different isoforms [TaxId: 132961]}
nliqfknmiqcagtrpwtayvnygcycgkggsgtpvdeldrccythdncyneaekipgcn
pniktysytctepnltctdtadtcarflcncdrtaaicfasapynsnnvmissstncq

Timeline for d1fe5a_:

• d1fe5a_ first appeared (with stable ids) in SCOP 1.55
  
• d1fe5a_ appears in SCOPe 2.05
  
• d1fe5a_ appears in SCOPe 2.07
  
• d1fe5a_ appears in the current release, SCOPe 2.08