![]() | Class a: All alpha proteins [46456] (226 folds) |
![]() | Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulfide-linked, and a calcium-binding loop |
![]() | Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) ![]() |
![]() | Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins) |
![]() | Protein Snake phospholipase A2 [48624] (35 species) |
![]() | Species Indian krait (Bungarus caeruleus), different isoforms [TaxId:132961] [48636] (7 PDB entries) |
![]() | Domain d1fe5a_: 1fe5 A: [19563] complexed with ca |
PDB Entry: 1fe5 (more details), 2.45 Å
SCOP Domain Sequences for d1fe5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fe5a_ a.133.1.2 (A:) Snake phospholipase A2 {Indian krait (Bungarus caeruleus), different isoforms} nliqfknmiqcagtrpwtayvnygcycgkggsgtpvdeldrccythdncyneaekipgcn pniktysytctepnltctdtadtcarflcncdrtaaicfasapynsnnvmissstncq
Timeline for d1fe5a_: