Lineage for d1fe5a_ (1fe5 A:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 6695Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
  4. 6696Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (2 families) (S)
  5. 6701Family a.133.1.2: Vertebrate phospholipase A2 [48623] (4 proteins)
  6. 6765Protein Snake phospholipase A2 [48624] (12 species)
  7. 6804Species Indian krait (Bungarus caeruleus), different isoforms [TaxId:132961] [48636] (2 PDB entries)
  8. 6806Domain d1fe5a_: 1fe5 A: [19563]

Details for d1fe5a_

PDB Entry: 1fe5 (more details), 2.45 Å

PDB Description: sequence and crystal structure of a basic phospholipase a2 from common krait (bungarus caeruleus) at 2.4 resolution: identification and characterization of its pharmacological sites.

SCOP Domain Sequences for d1fe5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fe5a_ a.133.1.2 (A:) Snake phospholipase A2 {Indian krait (Bungarus caeruleus), different isoforms}
nliqfknmiqcagtrpwtayvnygcycgkggsgtpvdeldrccythdncyneaekipgcn
pniktysytctepnltctdtadtcarflcncdrtaaicfasapynsnnvmissstncq

SCOP Domain Coordinates for d1fe5a_:

Click to download the PDB-style file with coordinates for d1fe5a_.
(The format of our PDB-style files is described here.)

Timeline for d1fe5a_: