Lineage for d3qv2a_ (3qv2 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2894468Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2894469Protein automated matches [190689] (87 species)
    not a true protein
  7. 2894583Species Entamoeba (Entamoeba histolytica) [TaxId:5759] [195622] (1 PDB entry)
  8. 2894584Domain d3qv2a_: 3qv2 A: [195623]
    automated match to d1g55a_
    complexed with sah, so4

Details for d3qv2a_

PDB Entry: 3qv2 (more details), 2.15 Å

PDB Description: Structure Analysis of Entamoeba histolytica methyltransferase EhMeth
PDB Compounds: (A:) 5-cytosine DNA methyltransferase

SCOPe Domain Sequences for d3qv2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qv2a_ c.66.1.0 (A:) automated matches {Entamoeba (Entamoeba histolytica) [TaxId: 5759]}
qkqvnvieffsgigglrssyerssininatfipfdineiankiysknfkeevqvknldsi
sikqieslncntwfmsppcqpynnsimskhkdindpraksvlhlyrdilpylinkpkhif
ienvplfkeslvfkeiyniliknqyyikdiicspidigipnsrtryyvmarltpfkneiq
lhqekesmisnyldnnvnesysipsdlilkkgmlfdivgkddkrtccftksytkivegtg
siycpiephfipvkkaedllnknlryftpneikkihgfssnfttqidgltdkqqyqclgn
svscfviaqlmeylfddlke

SCOPe Domain Coordinates for d3qv2a_:

Click to download the PDB-style file with coordinates for d3qv2a_.
(The format of our PDB-style files is described here.)

Timeline for d3qv2a_: