Lineage for d1dpya_ (1dpy A:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (2 families) 
Family a.133.1.2: Vertebrate phospholipase A2 [48623] (4 proteins) Protein Snake phospholipase A2 [48624] (12 species) 
Species Indian krait (Bungarus caeruleus), different isoforms [TaxId:132961] [48636] (2 PDB entries) 
Domain d1dpya_: 1dpy A: [19562]
Details for d1dpya_
PDB Entry: 1dpy (more details), 2.45 Å
PDB Description: three-dimensional structure of a novel phospholipase a2 from indian common krait at 2.45 a resolution
SCOP Domain Sequences for d1dpya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dpya_ a.133.1.2 (A:) Snake phospholipase A2 {Indian krait (Bungarus caeruleus), different isoforms}
nliqfknmiqcagtriwtayvaygcycgkggsgtpvdeldrccythdhcyneaekipgcn
pniktysytctqpnltctdsadtcaqflcecdrtaaicfasapynsnnimlsstscq
SCOP Domain Coordinates for d1dpya_:
Click to download the PDB-style file with coordinates for d1dpya_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1dpya_:
- d1dpya_ appears in SCOP 1.57
- d1dpya_ appears in the current release, SCOPe 2.08
View in 3D