| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulfide-linked, and a calcium-binding loop |
Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) ![]() |
| Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins) automatically mapped to Pfam PF00068 |
| Protein Snake phospholipase A2 [48624] (38 species) |
| Species Indian krait (Bungarus caeruleus), different isoforms [TaxId:132961] [48636] (7 PDB entries) Uniprot Q6SLM1 # fragment; Uniprot Q9DF52 28-145 # ! 74% sequence identity |
| Domain d1dpya_: 1dpy A: [19562] complexed with na |
PDB Entry: 1dpy (more details), 2.45 Å
SCOPe Domain Sequences for d1dpya_:
Sequence, based on SEQRES records: (download)
>d1dpya_ a.133.1.2 (A:) Snake phospholipase A2 {Indian krait (Bungarus caeruleus), different isoforms [TaxId: 132961]}
nliqfknmiqcagtriwtayvaygcycgkggsgtpvdeldrccythdhcyneaekipgcn
pniktysytctqpnltctdsadtcaqflcecdrtaaicfasapynsnnimlssstscq
>d1dpya_ a.133.1.2 (A:) Snake phospholipase A2 {Indian krait (Bungarus caeruleus), different isoforms [TaxId: 132961]}
nliqfknmiqcagtriwtayvaygcycgkggsgtpvdeldrccythdhcyneaekipgcn
pniktysytctqpnltctdsadtcaqflcecdrtaaicfasapynsnnimlsstscq
Timeline for d1dpya_: