Lineage for d1dpya_ (1dpy A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732915Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2732916Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2732921Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2733039Protein Snake phospholipase A2 [48624] (38 species)
  7. 2733143Species Indian krait (Bungarus caeruleus), different isoforms [TaxId:132961] [48636] (7 PDB entries)
    Uniprot Q6SLM1 # fragment; Uniprot Q9DF52 28-145 # ! 74% sequence identity
  8. 2733146Domain d1dpya_: 1dpy A: [19562]
    complexed with na

Details for d1dpya_

PDB Entry: 1dpy (more details), 2.45 Å

PDB Description: three-dimensional structure of a novel phospholipase a2 from indian common krait at 2.45 a resolution
PDB Compounds: (A:) phospholipase a2

SCOPe Domain Sequences for d1dpya_:

Sequence, based on SEQRES records: (download)

>d1dpya_ a.133.1.2 (A:) Snake phospholipase A2 {Indian krait (Bungarus caeruleus), different isoforms [TaxId: 132961]}
nliqfknmiqcagtriwtayvaygcycgkggsgtpvdeldrccythdhcyneaekipgcn
pniktysytctqpnltctdsadtcaqflcecdrtaaicfasapynsnnimlssstscq

Sequence, based on observed residues (ATOM records): (download)

>d1dpya_ a.133.1.2 (A:) Snake phospholipase A2 {Indian krait (Bungarus caeruleus), different isoforms [TaxId: 132961]}
nliqfknmiqcagtriwtayvaygcycgkggsgtpvdeldrccythdhcyneaekipgcn
pniktysytctqpnltctdsadtcaqflcecdrtaaicfasapynsnnimlsstscq

SCOPe Domain Coordinates for d1dpya_:

Click to download the PDB-style file with coordinates for d1dpya_.
(The format of our PDB-style files is described here.)

Timeline for d1dpya_: