SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3s8ec_ (3s8e C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2100990Fold c.17: Caspase-like [52128] (1 superfamily)
    3 layers, a/b/a; core: mixed beta-sheet of 6 strands, order 213456, strand 6 is antiparallel to the rest
  4. 2100991Superfamily c.17.1: Caspase-like [52129] (3 families) (S)
    mature protein may be composed of two chains folded in a single domain
  5. 2101162Family c.17.1.0: automated matches [191651] (1 protein)
    not a true family
  6. 2101163Protein automated matches [191201] (1 species)
    not a true protein
  7. 2101164Species Human (Homo sapiens) [TaxId:9606] [189525] (14 PDB entries)
  8. 2101197Domain d3s8ec_: 3s8e C: [195611]
    automated match to d3od5a_

Details for d3s8ec_

PDB Entry: 3s8e (more details), 2.88 Å

PDB Description: Phosphorylation regulates assembly of the caspase-6 substrate-binding groove
PDB Compounds: (C:) Caspase-6

SCOPe Domain Sequences for d3s8ec_:

Sequence, based on SEQRES records: (download)

>d3s8ec_ c.17.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mfdpaekykmdhrrrgialifnherffwhltlperrgtcadrdnltrrfsdlgfevkcfn
dlkaeelllkihevstvshadadcfvcvflshgegnhiyaydakieiqtltglfkgdkch
slvgkpkifiiqacrgnqhdvpvipldvvdnqtekldtnitevdaasvytlpagadflmc
ysvaegyyshretvngswyiqdlcemlgkygssleftelltlvnrkvdqrrvdfckdpsa
igkkqvpcfasmltkklhffpks

Sequence, based on observed residues (ATOM records): (download)

>d3s8ec_ c.17.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mfdpaekykmdhrrrgialifnherffwhltlperrgtcadrdnltrrfsdlgfevkcfn
dlkaeelllkihevstvshadadcfvcvflshgegnhiyaydakieiqtltglfkgdkch
slvgkpkifiiqacsvytlpagadflmcysvaetvngswyiqdlcemlgkygssleftel
ltlvnrkvdqrrvdfaigkkqvpcfasmltkklhffpks

SCOPe Domain Coordinates for d3s8ec_:

Click to download the PDB-style file with coordinates for d3s8ec_.
(The format of our PDB-style files is described here.)

Timeline for d3s8ec_: