SCOPe 2.02: Domain d3sora_: 3sor A:

Lineage for d3sora_ (3sor A:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)

6. Protein Coagulation factor XI [117237] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117238] (26 PDB entries)
   Uniprot P03951 388-624

8. Domain d3sora_: 3sor A: [195610]
   automated match to d3bg8a_
   complexed with cit, o58

Details for d3sora_

PDB Entry: 3sor, 1.8 Å

PDB Description: Factor XIa in complex with a clorophenyl-tetrazole inhibitor

PDB Compounds: (A:) Coagulation factor XI

SCOPe Domain Sequences for d3sora_:

Sequence; same for both SEQRES and ATOM records:

>d3sora_ b.47.1.2 (A:) Coagulation factor XI {Human (Homo sapiens) [TaxId: 9606]}
ivggtasvrgewpwqvtlhttsptqrhlcggsiignqwiltaahcfygvespkilrvysg
ilnqseikedtsffgvqeiiihdqykmaesgydiallklettvnytdsqrpislpskgdr
nviytdcwvtgwgyrklrdkiqntlqkakiplvtneecqkryrghkithkmicagyregg
kdackgdsggplsckhnevwhlvgitswgegcaqrerpgvytnvveyvdwilektq

Timeline for d3sora_:

• d3sora_ is new in SCOPe 2.02-stable
  
• d3sora_ appears in SCOPe 2.03
  
• d3sora_ appears in the current release, SCOPe 2.07