![]() | Class a: All alpha proteins [46456] (202 folds) |
![]() | Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulfide-linked, and a calcium-binding loop |
![]() | Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) ![]() |
![]() | Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins) |
![]() | Protein Snake phospholipase A2 [48624] (33 species) |
![]() | Species Sand viper (Vipera ammodytes meridionalis), vipoxin catalytic subunit [TaxId:8704] [88518] (2 PDB entries) |
![]() | Domain d1aokb_: 1aok B: [19561] complex with inhibitory subunit complexed with act |
PDB Entry: 1aok (more details), 2 Å
SCOP Domain Sequences for d1aokb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aokb_ a.133.1.2 (B:) Snake phospholipase A2 {Sand viper (Vipera ammodytes meridionalis), vipoxin catalytic subunit} nlfqfakmingklgafsvwnyisygcycgwggqgtpkdatdrccfvhdccygrvrgcnpk laiyyysfkkgnivcgknngclrdicecdrvaancfhqnkntynanykflsssrcrqtge kc
Timeline for d1aokb_: