Lineage for d3t2xb_ (3t2x B:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1133645Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 1133646Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 1134033Family b.61.1.0: automated matches [191402] (1 protein)
    not a true family
  6. 1134034Protein automated matches [190537] (4 species)
    not a true protein
  7. 1134042Species Shewanella denitrificans [TaxId:318161] [195517] (2 PDB entries)
  8. 1134044Domain d3t2xb_: 3t2x B: [195603]
    automated match to d1kl4b_
    mutant

Details for d3t2xb_

PDB Entry: 3t2x (more details), 1.15 Å

PDB Description: Structure of shwanavidin low affinity mutant (F43A)
PDB Compounds: (B:) Avidin/streptavidin

SCOPe Domain Sequences for d3t2xb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3t2xb_ b.61.1.0 (B:) automated matches {Shewanella denitrificans [TaxId: 318161]}
maqeltamsawvnqdgstlyinsinaqgeltgsyinraagaacqnspypvngwvfgtais
fstkwlnsvescnsitswsgfyintggqgkistlwqlvvngssspsqilkgqdvfsqts

SCOPe Domain Coordinates for d3t2xb_:

Click to download the PDB-style file with coordinates for d3t2xb_.
(The format of our PDB-style files is described here.)

Timeline for d3t2xb_: