SCOPe 2.02: Domain d3awhb_: 3awh B:

Lineage for d3awhb_ (3awh B:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.45: Split barrel-like [50474] (3 superfamilies)
   barrel; n=6, S=10; greek-key

4. Superfamily b.45.1: FMN-binding split barrel [50475] (5 families)
   related to the ferredoxin reductase-like FAD-binding domain

5. Family b.45.1.1: PNP-oxidase like [50476] (17 proteins)

6. Protein FMN-binding protein [50477] (1 species)

7. Species Desulfovibrio vulgaris, strain Miyazaki F [TaxId:881] [50478] (10 PDB entries)

8. Domain d3awhb_: 3awh B: [195589]
   automated match to d3a6ra_
   complexed with cl, fmn; mutant

Details for d3awhb_

PDB Entry: 3awh, 1.6 Å

PDB Description: E13K mutant of FMN-binding protein from Desulfovibrio vulgaris (Miyazaki F)

PDB Compounds: (B:) fmn-binding protein

SCOPe Domain Sequences for d3awhb_:

Sequence; same for both SEQRES and ATOM records:

>d3awhb_ b.45.1.1 (B:) FMN-binding protein {Desulfovibrio vulgaris, strain Miyazaki F [TaxId: 881]}
mlpgtffevlknkgvvaiatqgedgphlvntwnsylkvldgnrivvpvggmhkteanvar
dervlmtlgsrkvagrngpgtgflirgsaafrtdgpefeaiarfkwaraalvitvvsaeq
tl

Timeline for d3awhb_:

• d3awhb_ is new in SCOPe 2.02-stable
  
• d3awhb_ appears in SCOPe 2.03
  
• d3awhb_ appears in the current release, SCOPe 2.08