Class b: All beta proteins [48724] (174 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins) |
Protein automated matches [190044] (13 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187233] (122 PDB entries) |
Domain d4dgja_: 4dgj A: [195586] automated match to d1ekbb_ |
PDB Entry: 4dgj (more details), 1.9 Å
SCOPe Domain Sequences for d4dgja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dgja_ b.47.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ivggsdakegawpwvvglyyddrllcgaslvssdwlvsaahcvygrnlepskwtailglh mksnltspqtvprlideivinphynrrrkdndiammhlefkvnytdyiqpislpeenqvf ppgrncsiagwgtvvyqgttadilqeadvpllsnercqqqmpeynitenmicagyeeggi dscqgdsggplmcqennrwflagvtsfgyecalpnrpgvyarvsrftewiqsflh
Timeline for d4dgja_: