Lineage for d4dgja_ (4dgj A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1127558Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1127559Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1127765Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)
  6. 1129221Protein automated matches [190044] (13 species)
    not a true protein
  7. 1129253Species Human (Homo sapiens) [TaxId:9606] [187233] (122 PDB entries)
  8. 1129290Domain d4dgja_: 4dgj A: [195586]
    automated match to d1ekbb_

Details for d4dgja_

PDB Entry: 4dgj (more details), 1.9 Å

PDB Description: structure of a human enteropeptidase light chain variant
PDB Compounds: (A:) Enteropeptidase catalytic light chain

SCOPe Domain Sequences for d4dgja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dgja_ b.47.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ivggsdakegawpwvvglyyddrllcgaslvssdwlvsaahcvygrnlepskwtailglh
mksnltspqtvprlideivinphynrrrkdndiammhlefkvnytdyiqpislpeenqvf
ppgrncsiagwgtvvyqgttadilqeadvpllsnercqqqmpeynitenmicagyeeggi
dscqgdsggplmcqennrwflagvtsfgyecalpnrpgvyarvsrftewiqsflh

SCOPe Domain Coordinates for d4dgja_:

Click to download the PDB-style file with coordinates for d4dgja_.
(The format of our PDB-style files is described here.)

Timeline for d4dgja_: