Lineage for d4dgjb_ (4dgj B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2404157Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2404158Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2404432Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2406349Protein automated matches [190044] (14 species)
    not a true protein
  7. 2406399Species Human (Homo sapiens) [TaxId:9606] [187233] (166 PDB entries)
  8. 2406427Domain d4dgjb_: 4dgj B: [195585]
    automated match to d1ekbb_

Details for d4dgjb_

PDB Entry: 4dgj (more details), 1.9 Å

PDB Description: structure of a human enteropeptidase light chain variant
PDB Compounds: (B:) Enteropeptidase catalytic light chain

SCOPe Domain Sequences for d4dgjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dgjb_ b.47.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ivggsdakegawpwvvglyyddrllcgaslvssdwlvsaahcvygrnlepskwtailglh
mksnltspqtvprlideivinphynrrrkdndiammhlefkvnytdyiqpislpeenqvf
ppgrncsiagwgtvvyqgttadilqeadvpllsnercqqqmpeynitenmicagyeeggi
dscqgdsggplmcqennrwflagvtsfgyecalpnrpgvyarvsrftewiqsflh

SCOPe Domain Coordinates for d4dgjb_:

Click to download the PDB-style file with coordinates for d4dgjb_.
(The format of our PDB-style files is described here.)

Timeline for d4dgjb_: