Lineage for d4dgjc_ (4dgj C:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2064170Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2064171Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2064431Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2066146Protein automated matches [190044] (14 species)
    not a true protein
  7. 2066187Species Human (Homo sapiens) [TaxId:9606] [187233] (146 PDB entries)
  8. 2066226Domain d4dgjc_: 4dgj C: [195584]
    automated match to d1ekbb_

Details for d4dgjc_

PDB Entry: 4dgj (more details), 1.9 Å

PDB Description: structure of a human enteropeptidase light chain variant
PDB Compounds: (C:) Enteropeptidase catalytic light chain

SCOPe Domain Sequences for d4dgjc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dgjc_ b.47.1.2 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ivggsdakegawpwvvglyyddrllcgaslvssdwlvsaahcvygrnlepskwtailglh
mksnltspqtvprlideivinphynrrrkdndiammhlefkvnytdyiqpislpeenqvf
ppgrncsiagwgtvvyqgttadilqeadvpllsnercqqqmpeynitenmicagyeeggi
dscqgdsggplmcqennrwflagvtsfgyecalpnrpgvyarvsrftewiqsfl

SCOPe Domain Coordinates for d4dgjc_:

Click to download the PDB-style file with coordinates for d4dgjc_.
(The format of our PDB-style files is described here.)

Timeline for d4dgjc_: