Lineage for d1vip__ (1vip -)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 544466Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 544467Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) (S)
  5. 544472Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)
  6. 544553Protein Snake phospholipase A2 [48624] (35 species)
  7. 544667Species Russell's viper (Vipera russelli) [TaxId:8707] [48634] (1 PDB entry)
    anticoagulant class II phospholipase A2
  8. 544668Domain d1vip__: 1vip - [19558]
    complexed with so4

Details for d1vip__

PDB Entry: 1vip (more details), 2.2 Å

PDB Description: anticoagulant class ii phospholipase a2 from the venom of vipera russelli russelli

SCOP Domain Sequences for d1vip__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vip__ a.133.1.2 (-) Snake phospholipase A2 {Russell's viper (Vipera russelli)}
nlfqfaemivkmtgknplssysdygcycgwggkgkpqdatdrccfvhdccyekvksckpk
lslysysfqnggivcgdnhsckravcecdrvaatcfrdnlntydkkyhnyppsqctgteq
c

SCOP Domain Coordinates for d1vip__:

Click to download the PDB-style file with coordinates for d1vip__.
(The format of our PDB-style files is described here.)

Timeline for d1vip__: