Lineage for d1vip__ (1vip -)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (2 families) 
Family a.133.1.2: Vertebrate phospholipase A2 [48623] (4 proteins) Protein Snake phospholipase A2 [48624] (12 species) 
Species Russell's viper (Vipera russelli) [TaxId:8707] [48634] (1 PDB entry) 
Domain d1vip__: 1vip - [19558]
Details for d1vip__
PDB Entry: 1vip (more details), 2.2 Å
PDB Description: anticoagulant class ii phospholipase a2 from the venom of vipera russelli russelli
SCOP Domain Sequences for d1vip__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vip__ a.133.1.2 (-) Snake phospholipase A2 {Russell's viper (Vipera russelli)}
nlfqfaemivkmtgknplssysdygcycgwggkgkpqdatdrccfvhdccyekvksckpk
lslysysfqnggivcgdnhsckravcecdrvaatcfrdnlntydkkyhnyppsqctgteq
c
SCOP Domain Coordinates for d1vip__:
Click to download the PDB-style file with coordinates for d1vip__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1vip__:
- d1vip__ appears in SCOP 1.57
- d1vip__ appears in the current release, SCOPe 2.08, called d1vipa_
View in 3D