Lineage for d4eeib1 (4eei B:1-432)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2010255Fold a.127: L-aspartase-like [48556] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. 2010256Superfamily a.127.1: L-aspartase-like [48557] (3 families) (S)
  5. 2010426Family a.127.1.0: automated matches [191431] (1 protein)
    not a true family
  6. 2010427Protein automated matches [190621] (20 species)
    not a true protein
  7. 2010437Species Francisella tularensis [TaxId:177416] [195577] (2 PDB entries)
  8. 2010439Domain d4eeib1: 4eei B:1-432 [195578]
    Other proteins in same PDB: d4eeia2, d4eeib2
    automated match to d1c3ca_
    complexed with amp, cl, edo, k, sin

Details for d4eeib1

PDB Entry: 4eei (more details), 1.92 Å

PDB Description: Crystal Structure of Adenylosuccinate Lyase from Francisella tularensis Complexed with AMP and Succinate
PDB Compounds: (B:) adenylosuccinate lyase

SCOPe Domain Sequences for d4eeib1:

Sequence, based on SEQRES records: (download)

>d4eeib1 a.127.1.0 (B:1-432) automated matches {Francisella tularensis [TaxId: 177416]}
mikrydvaeiskiwadenkyakmlevelailealedrmvpkgtaaeiraraqirpervde
iekvtkhdiiafctsiaeqftaetgkffhfgvtssdiidsalslqirdsmsyvikdleal
cdslltkaeetkeiitmgrshgmfaepmsfgqkflgayvefkrrlkdlkdfqkdgltvqf
sgavgnycilttedekkaadilglpveevstqviprdriaklisihgliasaierlavei
rhlhrsdvfevyegfskgqkgsstmphkknpistenltgmarmlrshvsialencvlwhe
rdishssaerfylpdnfgimvyalrrmkntidnlvvqrdiiedrvrstsaylssfylhfl
vantpfmredcykivqqvafdlkqgesfskklqkvmhdehniildipemdfegikktylk
eidhvfdrsvka

Sequence, based on observed residues (ATOM records): (download)

>d4eeib1 a.127.1.0 (B:1-432) automated matches {Francisella tularensis [TaxId: 177416]}
mikrydvaeiskiwadenkyakmlevelailealedrmvpkgtaaeiraraqirpervde
iekvtkhdiiafctsiaeqftaetgkffhfgvtssdiidsalslqirdsmsyvikdleal
cdslltkaeetkeiitmgrshgmfaepmsfgqkflgayvefkrrlkdlkdfqkdgltvqf
sgavgnycilttedekkaadilglpveevstqviprdriaklisihgliasaierlavei
rhlhrsdvfevyegfkknpistenltgmarmlrshvsialencvlwherdishssaerfy
lpdnfgimvyalrrmkntidnlvvqrdiiedrvrstsaylssfylhflvantpfmredcy
kivqqvafdlesfskklqkvmhdehniildipemdfegikktylkeidhvfdrsvka

SCOPe Domain Coordinates for d4eeib1:

Click to download the PDB-style file with coordinates for d4eeib1.
(The format of our PDB-style files is described here.)

Timeline for d4eeib1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4eeib2