SCOPe 2.06: Domain d1qllb_: 1qll B:

Lineage for d1qllb_ (1qll B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
   automatically mapped to Pfam PF00068

6. Protein Snake phospholipase A2 [48624] (38 species)

7. Species Bothrops pirajai, Piratoxin-II (PRTX-II) [TaxId:113192] [48633] (3 PDB entries)

8. Domain d1qllb_: 1qll B: [19557]
   complexed with tda

Details for d1qllb_

PDB Entry: 1qll, 2.04 Å

PDB Description: piratoxin-ii (prtx-ii) - a k49 pla2 from bothrops pirajai

PDB Compounds: (B:) phospholipase a2

SCOPe Domain Sequences for d1qllb_:

Sequence; same for both SEQRES and ATOM records:

>d1qllb_ a.133.1.2 (B:) Snake phospholipase A2 {Bothrops pirajai, Piratoxin-II (PRTX-II) [TaxId: 113192]}
slfelgkmilqetgknpaksygaygcncgvlgrgkpkdatdrccyvhkccykkltgcnpk
kdrysyswkdktivcgennpclkelcecdkavaiclrenlgtynkkyryhlkpfckkadk
c

Timeline for d1qllb_:

• d1qllb_ first appeared (with stable ids) in SCOP 1.55
  
• d1qllb_ appears in SCOPe 2.05
  
• d1qllb_ appears in SCOPe 2.07
  
• d1qllb_ appears in the current release, SCOPe 2.08