Lineage for d1qllb_ (1qll B:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 449032Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 449033Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) (S)
  5. 449038Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)
  6. 449118Protein Snake phospholipase A2 [48624] (35 species)
  7. 449121Species Bothrops pirajai, Piratoxin-II (PRTX-II) [TaxId:113192] [48633] (1 PDB entry)
  8. 449123Domain d1qllb_: 1qll B: [19557]

Details for d1qllb_

PDB Entry: 1qll (more details), 2.04 Å

PDB Description: piratoxin-ii (prtx-ii) - a k49 pla2 from bothrops pirajai

SCOP Domain Sequences for d1qllb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qllb_ a.133.1.2 (B:) Snake phospholipase A2 {Bothrops pirajai, Piratoxin-II (PRTX-II)}
slfelgkmilqetgknpaksygaygcncgvlgrgkpkdatdrccyvhkccykkltgcnpk
kdrysyswkdktivcgennpclkelcecdkavaiclrenlgtynkkyryhlkpfckkadk
c

SCOP Domain Coordinates for d1qllb_:

Click to download the PDB-style file with coordinates for d1qllb_.
(The format of our PDB-style files is described here.)

Timeline for d1qllb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1qlla_