Lineage for d1qllb_ (1qll B:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (2 families) 
Family a.133.1.2: Vertebrate phospholipase A2 [48623] (4 proteins) Protein Snake phospholipase A2 [48624] (12 species) 
Species Bothrops pirajai, Piratoxin-II (PRTX-II) [TaxId:113192] [48633] (1 PDB entry) 
Domain d1qllb_: 1qll B: [19557]
Details for d1qllb_
PDB Entry: 1qll (more details), 2.04 Å
PDB Description: piratoxin-ii (prtx-ii) - a k49 pla2 from bothrops pirajai
SCOP Domain Sequences for d1qllb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qllb_ a.133.1.2 (B:) Snake phospholipase A2 {Bothrops pirajai, Piratoxin-II (PRTX-II)}
slfelgkmilqetgknpaksygaygcncgvlgrgkpkdatdrccyvhkccykkltgcnpk
kdrysyswkdktivcgennpclkelcecdkavaiclrenlgtynkkyryhlkpfckkadk
c
SCOP Domain Coordinates for d1qllb_:
Click to download the PDB-style file with coordinates for d1qllb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qllb_:
- d1qllb_ appears in SCOP 1.57
- d1qllb_ appears in the current release, SCOPe 2.08
View in 3D
