Class a: All alpha proteins [46456] (290 folds) |
Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulfide-linked, and a calcium-binding loop |
Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) |
Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins) automatically mapped to Pfam PF00068 |
Protein Snake phospholipase A2 [48624] (38 species) |
Species Bothrops pirajai, Piratoxin-II (PRTX-II) [TaxId:113192] [48633] (3 PDB entries) |
Domain d1qllb_: 1qll B: [19557] complexed with tda |
PDB Entry: 1qll (more details), 2.04 Å
SCOPe Domain Sequences for d1qllb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qllb_ a.133.1.2 (B:) Snake phospholipase A2 {Bothrops pirajai, Piratoxin-II (PRTX-II) [TaxId: 113192]} slfelgkmilqetgknpaksygaygcncgvlgrgkpkdatdrccyvhkccykkltgcnpk kdrysyswkdktivcgennpclkelcecdkavaiclrenlgtynkkyryhlkpfckkadk c
Timeline for d1qllb_: