Lineage for d3udya1 (3udy A:-1-392)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2391025Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2391026Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2392462Family b.50.1.2: Pepsin-like [50646] (11 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 2392520Protein beta-secretase (memapsin) [50671] (1 species)
  7. 2392521Species Human (Homo sapiens) [TaxId:9606] [50672] (287 PDB entries)
    Uniprot P56817 58-446 ! Uniprot P56817 60-447
  8. 2392682Domain d3udya1: 3udy A:-1-392 [195569]
    Other proteins in same PDB: d3udya2
    automated match to d2qk5a_
    complexed with 09g, edo, peg, zn

Details for d3udya1

PDB Entry: 3udy (more details), 2 Å

PDB Description: crystal structure of bace with compound 11
PDB Compounds: (A:) Beta-secretase 1

SCOPe Domain Sequences for d3udya1:

Sequence, based on SEQRES records: (download)

>d3udya1 b.50.1.2 (A:-1-392) beta-secretase (memapsin) {Human (Homo sapiens) [TaxId: 9606]}
fvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyqrqlss
tyrdlrkgvyvpytqgkwegelgtdlvsiphgpnvtvraniaaitesdkffingsnwegi
lglayaeiarpddslepffdslvkqthvpnlfslqlcgagfplnqsevlasvggsmiigg
idhslytgslwytpirrewyyeviivrveingqdlkmdckeynydksivdsgttnlrlpk
kvfeaavksikaasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgevtnqsfri
tilpqqylrpvedvatsqddcykfaisqsstgtvmgavimegfyvvfdrarkrigfavsa
chvhdefrtaavegpfvtldmedcgynipqtdes

Sequence, based on observed residues (ATOM records): (download)

>d3udya1 b.50.1.2 (A:-1-392) beta-secretase (memapsin) {Human (Homo sapiens) [TaxId: 9606]}
fvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyqrqlss
tyrdlrkgvyvpytqgkwegelgtdlvsiphgpnvtvraniaaitesdkffingsnwegi
lglayaeiarpddslepffdslvkqthvpnlfslqlcgasevlasvggsmiiggidhsly
tgslwytpirrewyyeviivrveingqdlkmdckeynydksivdsgttnlrlpkkvfeaa
vksikaasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgevtnqsfritilpqq
ylrpvedvatsqddcykfaisqsstgtvmgavimegfyvvfdrarkrigfavsachvhde
frtaavegpfvtldmedcgynipqtdes

SCOPe Domain Coordinates for d3udya1:

Click to download the PDB-style file with coordinates for d3udya1.
(The format of our PDB-style files is described here.)

Timeline for d3udya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3udya2