Class a: All alpha proteins [46456] (284 folds) |
Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily) multihelical; 3 layers or orthogonally packed helices |
Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) |
Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins) |
Protein automated matches [190059] (12 species) not a true protein |
Species Gallus gallus [TaxId:9031] [195567] (1 PDB entry) |
Domain d3uvva_: 3uvv A: [195568] Other proteins in same PDB: d3uvvb_ automated match to d3ilza_ complexed with rea, t3 |
PDB Entry: 3uvv (more details), 2.95 Å
SCOPe Domain Sequences for d3uvva_:
Sequence, based on SEQRES records: (download)
>d3uvva_ a.123.1.1 (A:) automated matches {Gallus gallus [TaxId: 9031]} emikslqhrpspsaeewelihvvteahrstnaqgshwkqkrkflpedigqspmasmpdgd kvdleafseftkiitpaitrvvdfakklpmfselpcedqiillkgccmeimslraavryd pesetltlsgemavkreqlkngglgvvsdaifdlgkslsafnlddtevallqavllmssd rtglicvdkiekcqetyllafehyinyrkhniphfwpkllmkvtdlrmigachasrflhm kvecptelfpplflevfed
>d3uvva_ a.123.1.1 (A:) automated matches {Gallus gallus [TaxId: 9031]} emikslqhrpspsaeewelihvvteahrstnaqgshwkqkrkflpedipddkvdleafse ftkiitpaitrvvdfakklpmfselpcedqiillkgccmeimslraavrydpesetltls gemavkreqlkngglgvvsdaifdlgkslsafnlddtevallqavllmssdrtglicvdk iekcqetyllafehyinyrkhniphfwpkllmkvtdlrmigachasrflhmkvecptelf pplflevfed
Timeline for d3uvva_: