Lineage for d3uvva1 (3uvv A:148-405)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2009403Protein automated matches [190059] (14 species)
    not a true protein
  7. 2009419Species Chicken (Gallus gallus) [TaxId:9031] [195567] (1 PDB entry)
  8. 2009420Domain d3uvva1: 3uvv A:148-405 [195568]
    Other proteins in same PDB: d3uvva2, d3uvvb_
    automated match to d3ilza_
    complexed with rea, t3

Details for d3uvva1

PDB Entry: 3uvv (more details), 2.95 Å

PDB Description: crystal structure of the ligand binding domains of the thyroid receptor:retinoid x receptor complexed with 3,3',5 triiodo-l- thyronine and 9-cis retinoic acid
PDB Compounds: (A:) Thyroid hormone receptor alpha

SCOPe Domain Sequences for d3uvva1:

Sequence, based on SEQRES records: (download)

>d3uvva1 a.123.1.1 (A:148-405) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
mikslqhrpspsaeewelihvvteahrstnaqgshwkqkrkflpedigqspmasmpdgdk
vdleafseftkiitpaitrvvdfakklpmfselpcedqiillkgccmeimslraavrydp
esetltlsgemavkreqlkngglgvvsdaifdlgkslsafnlddtevallqavllmssdr
tglicvdkiekcqetyllafehyinyrkhniphfwpkllmkvtdlrmigachasrflhmk
vecptelfpplflevfed

Sequence, based on observed residues (ATOM records): (download)

>d3uvva1 a.123.1.1 (A:148-405) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
mikslqhrpspsaeewelihvvteahrstnaqgshwkqkrkflpedipddkvdleafsef
tkiitpaitrvvdfakklpmfselpcedqiillkgccmeimslraavrydpesetltlsg
emavkreqlkngglgvvsdaifdlgkslsafnlddtevallqavllmssdrtglicvdki
ekcqetyllafehyinyrkhniphfwpkllmkvtdlrmigachasrflhmkvecptelfp
plflevfed

SCOPe Domain Coordinates for d3uvva1:

Click to download the PDB-style file with coordinates for d3uvva1.
(The format of our PDB-style files is described here.)

Timeline for d3uvva1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3uvva2
View in 3D
Domains from other chains:
(mouse over for more information)
d3uvvb_