SCOPe 2.08: Domain d3uvvb_: 3uvv B:

Lineage for d3uvvb_ (3uvv B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
   multihelical; 3 layers or orthogonally packed helices

4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families)

5. Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)

6. Protein Retinoid-X receptor alpha (RXR-alpha) [48510] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48511] (38 PDB entries)
   Uniprot P19793 227-458

8. Domain d3uvvb_: 3uvv B: [195566]
   Other proteins in same PDB: d3uvva1, d3uvva2
   automated match to d1lbda_
   complexed with 9cr, t3

Details for d3uvvb_

PDB Entry: 3uvv, 2.95 Å

PDB Description: crystal structure of the ligand binding domains of the thyroid receptor:retinoid x receptor complexed with 3,3',5 triiodo-l- thyronine and 9-cis retinoic acid

PDB Compounds: (B:) Retinoic acid receptor RXR-alpha

SCOPe Domain Sequences for d3uvvb_:

Sequence, based on SEQRES records:

>d3uvvb_ a.123.1.1 (B:) Retinoid-X receptor alpha (RXR-alpha) {Human (Homo sapiens) [TaxId: 9606]}
nedmpverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvewakri
phfselplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvgaif
drvltelvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayckh
kypeqpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleap

Sequence, based on observed residues (ATOM records):

>d3uvvb_ a.123.1.1 (B:) Retinoid-X receptor alpha (RXR-alpha) {Human (Homo sapiens) [TaxId: 9606]}
nedmpverileaelavepktpndpvtnicqaadkqlftlvewakriphfselplddqvil
lragwnelliasfshrsiavkdgillatglhvhrnsahsagvgaifdrvltelvskmrdm
qmdktelgclraivlfnpdskglsnpaevealrekvyasleayckhkypeqpgrfaklll
rlpalrsiglkclehlfffkligdtpidtflmemleap

Timeline for d3uvvb_:

• d3uvvb_ first appeared in SCOPe 2.02
  
• d3uvvb_ appears in SCOPe 2.07