Lineage for d3vlba_ (3vlb A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2391025Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2391026Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2393810Family b.50.1.0: automated matches [191552] (1 protein)
    not a true family
  6. 2393811Protein automated matches [190954] (11 species)
    not a true protein
  7. 2393834Species Carrot (Daucus carota) [TaxId:4039] [195560] (2 PDB entries)
  8. 2393836Domain d3vlba_: 3vlb A: [195564]
    Other proteins in same PDB: d3vlbb_, d3vlbd_
    automated match to d3hd8c_

Details for d3vlba_

PDB Entry: 3vlb (more details), 2.7 Å

PDB Description: Crystal structure of xeg-edgp
PDB Compounds: (A:) edgp

SCOPe Domain Sequences for d3vlba_:

Sequence, based on SEQRES records: (download)

>d3vlba_ b.50.1.0 (A:) automated matches {Carrot (Daucus carota) [TaxId: 4039]}
rpsalvvpvkkdastlqyvttinqrtplvsenlvvdlggrflwvdcdqnyvsstyrpvrc
rtsqcslsgsiacgdcfngprpgcnnntcgvfpenpvintatggevaedvvsvestdgss
sgrvvtvprfifscaptsllqnlasgvvgmaglgrtrialpsqfasafsfkrkfamclsg
stssnsviifgndpytflpniivsdktltytplltnpvstsatstqgepsveyfigvksi
kinskivalntsllsissaglggtkistinpytvletsiykavteafikesaarnitrva
svapfgacfstdnilstrlgpsvpsidlvlqsesvvwtitgsnsmvyindnvvclgvvdg
gsnlrtsivigghqlednlvqfdlatsrvgfsgtllgsrttcanfnft

Sequence, based on observed residues (ATOM records): (download)

>d3vlba_ b.50.1.0 (A:) automated matches {Carrot (Daucus carota) [TaxId: 4039]}
rpsalvvpvkkdastlqyvttinqrtplvsenlvvdlggrflwvdcdqnyvsstyrpvrc
rtsqcslsgsiacgdcfnggcnnntcgvfpenpvintatggevaedvvsvestdgsssgr
vvtvprfifscaptsllqnlasgvvgmaglgrtrialpsqfasafsfkrkfamclsgsts
snsviifgndpytflpniivsdktltytplltnpvstsattqgepsveyfigvksikins
kivalntsllsissaglggtkistinpytvletsiykavteafikesaarnitrvasvap
fgacfstdnilstrlgpsvpsidlvlqsesvvwtitgsnsmvyindnvvclgvvdggsnl
rtsivigghqlednlvqfdlatsrvgfsgtllgsrttcanfnft

SCOPe Domain Coordinates for d3vlba_:

Click to download the PDB-style file with coordinates for d3vlba_.
(The format of our PDB-style files is described here.)

Timeline for d3vlba_: