Lineage for d3vlbb_ (3vlb B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780621Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2780622Protein automated matches [190437] (70 species)
    not a true protein
  7. 2780849Species Fungus (Aspergillus aculeatus) [TaxId:5053] [195557] (6 PDB entries)
  8. 2780869Domain d3vlbb_: 3vlb B: [195563]
    Other proteins in same PDB: d3vlba_, d3vlbc_
    automated match to d1oa2a_

Details for d3vlbb_

PDB Entry: 3vlb (more details), 2.7 Å

PDB Description: Crystal structure of xeg-edgp
PDB Compounds: (B:) Xyloglucan-specific endo-beta-1,4-glucanase A

SCOPe Domain Sequences for d3vlbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vlbb_ b.29.1.0 (B:) automated matches {Fungus (Aspergillus aculeatus) [TaxId: 5053]}
sdfcgqwdtatagdftlyndlwgesagtgsqctgvdsysgdtiawhtswswsggsssvks
yvnaaltftptqlncissipttwkwsysgssivadvaydtflaetasgsskyeimvwlaa
lggagpisstgstiatptiagvnwklysgpngdttvysfvadsttesfsgdlndfftylv
dnegvsdelylttleagtepftgsnakltvseysisie

SCOPe Domain Coordinates for d3vlbb_:

Click to download the PDB-style file with coordinates for d3vlbb_.
(The format of our PDB-style files is described here.)

Timeline for d3vlbb_: